PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.15697s0165.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HB-other
Protein Properties Length: 1709aa    MW: 192020 Da    PI: 5.1143
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.15697s0165.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.8e-193489257
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                           kR+  t+ qle+Le++++++ yps+++r++L++kl+L++rq ++WF+ rR k+kk
  Bostr.15697s0165.1.p 34 PKRQMKTPFQLETLEKVYAEETYPSEATRADLSEKLNLSDRQLQMWFCHRRLKDKK 89
                          69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-181989IPR009057Homeodomain-like
SuperFamilySSF466895.13E-162789IPR009057Homeodomain-like
PROSITE profilePS5007116.2443090IPR001356Homeobox domain
SMARTSM003896.0E-183294IPR001356Homeobox domain
PfamPF000461.0E-163489IPR001356Homeobox domain
CDDcd000861.52E-143589No hitNo description
PROSITE profilePS5082718.031545604IPR018501DDT domain
SMARTSM005714.6E-24545604IPR018501DDT domain
PfamPF027919.3E-18546601IPR018501DDT domain
PfamPF050669.0E-16727794IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156125.1E-7929968IPR028942WHIM1 domain
PfamPF156131.9E-1311021174IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1709 aa     Download sequence    Send to blast
MDMGSDEEDQ IRSVADVGGN NKKKKIDNSS SVKPKRQMKT PFQLETLEKV YAEETYPSEA  60
TRADLSEKLN LSDRQLQMWF CHRRLKDKKD GQSKKPGKSA VAVQPAALAS SVNDLPAARS  120
VPEQDSRSGS DSGSGCSPYS DSRRNFASGS SSSRAELDEY ETMGKASYEP RLSTMVRRAI  180
VCIEAQLGEP LRDDGPILGM EFDPLPPGAF GTPIAMHKHL LHPYESKMYE PHDVRPRRSQ  240
AAARSFHEQK SLDDPSSFTP DMYGRYSENH AHGMDYGIAR SRSSSFMHEN GPLPRSYGTP  300
GHASRNCSTS QQDMPSPIVA SAHRGDRFLM EKDSSVVGTE DPYLLPDGVR KSNDVHRKGK  360
IHDGRLGRGS ETRENRGPKD LEKLEIQRKK NEERMRKEME RNERERRKEE ERLMRERIKE  420
EERLQREQRR EMERREKFLQ REYERAEKKK QKEEIRREKD AIRRKIAIEK ATARRIAKES  480
MDLIEDEQLE LMELAAISKG LPSVLQLDHD TLQNLELYRD SLSTFPPEGL QLKLPFAISP  540
WKDSDESVGN LLMVWRFLTS FSDVLDLWPF TLDEFIQAFH DYDSRLLGEI HVTLLRSIIR  600
DIEDVARTPF SGIGNNQYTT ANPEGGHPQI VEGAYAWGFD IRSWKKNLNP LTWPEILRQL  660
ALSAGFGPRL KEKNSRLTHT GDKDEAKGYE DIISTIRSGS AAESAFALMR EKGLLAPRKS  720
RHRLTPGTVK FAAFHVLSLE GSKGLTVLEL ADKIQKSGLR DLTTSKTPEA SISVALTRDV  780
KLFERIAPST YCVRAPYVKD PADGEAILAD AKKKIRAFEN GFTGPEDVND LERDEEFEID  840
IDEDPEVDDL ATLASASKSA DLGEANVLSG KGGDTMFCDV KAGVKSELEK EFSSPPPSSM  900
KSIVPQHRER LKDTAVGYVD AMVDESNQGQ SWVQGLTEGD YCHLSVEERL NALVALVGIA  960
NEGNSIRAGL EDRMEAANSL KKQMWAEAQL DNSCVRDVLK LDFQNLASSK TESTMGLPII  1020
QSSTRERDSF DRDPSELLDE TKPLEVVSND LHKSSAERGL INQEANISQE NCSSQHGYAS  1080
KRSRSQLKSY IGHKAEEVYP YRSLPLGQDR RHNRYWHFAA SASKSDPSSG LLFVELHDGK  1140
WLLIDSEEAF DTLVASLDMR GIRESHLRIM LQKIEGSFKE NACKNIKLAR NPLLKEKSVM  1200
NHSPSDSVSP SSAISGLNSD SMETSTSIRV ELGRNNTEKK KLSKRFHDFQ RWMWTETYSS  1260
LPSCARKYGK KRSELLATCD VCVASYFSEY THCTSCHQRL DMVDSSEILD SGLTVSPLPF  1320
GVRLLKPLLV SLEASVPDEA LESFWTEDKR KIWGFRLNAS SSPEELLQVL TSLESAIKKE  1380
YLSSNFMSAK ELLGVGDADA DDPGSVDVLP WIPKTVSAVA LRLSELDASI IYVKPEKPGL  1440
IPEDENEQIS LFPGDSLSKG KGPREQEDQD EVVPNSGNRR SNKRARVSLG SGSNRKVKRK  1500
KAQGGPSRFV VSRRNVAVDN NLMSVELSHQ VPGRGKRTVR KRPERIDEDN DHIVNRMADI  1560
VRPKSQEVEE DEEEEEQTFR DIDEDWAAGE TPREMDEDWA NETPNRMMTP MQVDDESDNS  1620
VGVESEDDDD VDGQFVDYSQ RNKWGFNWNS NPNEAVEDEE EVVGVERVEG KDNAEMSESS  1680
EDDDVPASNA ANNYDRESEG YSSSDSGT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18289RRLKDKKD
214931500NRKVKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0101550.0AC010155.3 Genomic sequence for Arabidopsis thaliana BAC F3M18 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010499372.10.0PREDICTED: uncharacterized protein LOC104776906
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLD7KCW80.0D7KCW8_ARALL; HB-1
STRINGfgenesh2_kg.1__3015__AT1G28420.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83472236
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1